PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A07G1601
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 179aa    MW: 20661.1 Da    PI: 6.7248
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A07G1601genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1513.1e-1682140563
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                  +++rr+++NRe+ArrsR RK+  ++eL   v  L +eN++L+++l++ ++  +k+ +e+
  Gh_A07G1601  82 RKQRRMISNRESARRSRMRKQRHLDELWAQVVWLRNENHQLIDKLNHVSESHDKVLQEN 140
                  689*************************************************9999988 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.7E-1678142IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.34680143IPR004827Basic-leucine zipper domain
PfamPF001704.8E-1482140IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.63E-1382132No hitNo description
Gene3DG3DSA:1.20.5.1701.2E-1282154No hitNo description
CDDcd147023.16E-1983134No hitNo description
PROSITE patternPS00036085100IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 179 aa     Download sequence    Send to blast
MQPSEVSGIQ YLVPSNPSPY SPHFSMNQSN KPALDSNQFL NPLYNFYIPP QIQDISPHSS  60
CISSNSTSDE ADEQQLSLII ERKQRRMISN RESARRSRMR KQRHLDELWA QVVWLRNENH  120
QLIDKLNHVS ESHDKVLQEN TQLKEEASEL RQMLFGMRLG HPNSTSVKVD DVALEHGLS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
194101RRSRMRKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.111880.0boll
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012488166.11e-119PREDICTED: basic leucine zipper 43-like
SwissprotQ9FMC22e-41BZP43_ARATH; Basic leucine zipper 43
TrEMBLA0A0D2PUP21e-119A0A0D2PUP2_G
STRINGPOPTR_0004s10990.11e-81(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31122667
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30530.12e-44basic leucine-zipper 42